Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human SCF Protein

Cat. No.: IBDP-530651

Size:

Target Information

Synonyms Kit Ligand|||Mast Cell Growth Factor|||MGF|||Stem Cell Factor|||SCF|||c-Kit ligand|||KITLG|||MGF|||SCF
Sequence EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Function SCF, as a recombinant protein, plays essential roles in gametogenesis, melanogenesis and hematopoiesis. SCF also plays an important role in nervous system.

Product Details

Product Type Protein
Species Human
Source E. coli
Tag Tag Free
Endotoxin Level <1.0 Eu/µg
Molecular Weight 19 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.