Recombinant Human S100A9 Protein

Target Information

Sequence	TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKK ENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGP GHHHKPGLGEGTP
Sequence Similarities	Belongs to the S-100 family. Contains 2 EF-hand domains.
Amino Acids	2 to 114
Cellular Localization	Secreted. Cytoplasm. Cytoplasm > cytoskeleton. Cell membrane. Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM-CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes. Serum levels are high in patients suffering from chronic inflammation.
Tissue Specificity	Expressed by macrophages in acutely inflammed tissues and in chronic inflammation. Detected in peripheral blood leukocytes, in neutrophils and granulocytes. Detected at sites of vascular inflammation (at protein level). Also expressed in epithelial cells constitutively or induced during dermatoses.
Function	Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS) (By similarity). Promotes tubulin polymerization when unphosphorylated. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as a pro-inflammatory mediator in acute and chronic inflammation and up-regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Endotoxin Level	≤0.005 Eu/µg
Protein Length	Full length protein
Molecular Weight	13 kDa
Purity	≥95%
Active	No
Animal free	Yes
Nature	Recombinant
Application	MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.