Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human S100 alpha 6/PRA Protein

Cat. No.: IBDP-530317

Size:

Target Information

Sequence MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQD AEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Sequence Similarities Belongs to the S-100 family. Contains 2 EF-hand domains.
Amino Acids 1 to 90
Cellular Localization Nucleus envelope. Cytoplasm. Cell membrane.
Function May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.

Product Details

Product Type Protein
Species Human
Source E. coli
Endotoxin Level <0.1 Eu/μg
Protein Length Full length protein
Molecular Weight 10 kDa
Purity >95%
Active No
Animal free No
Nature Recombinant
Application SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.