Cat. No.: IBDP-530317
Size:
Online InquiryTarget Information
Sequence | MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQD AEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG |
Sequence Similarities | Belongs to the S-100 family. Contains 2 EF-hand domains. |
Amino Acids | 1 to 90 |
Cellular Localization | Nucleus envelope. Cytoplasm. Cell membrane. |
Function | May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative. |
Product Details
Product Type | Protein |
Species | Human |
Source | E. coli |
Endotoxin Level | <0.1 Eu/μg |
Protein Length | Full length protein |
Molecular Weight | 10 kDa |
Purity | >95% |
Active | No |
Animal free | No |
Nature | Recombinant |
Application | SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |