Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human RCVRN Protein

Cat. No.: IBDP-530779

Size:

Target Information

Synonyms 23 kDa photoreceptor cell-specific protein|||Cancer associated retinopathy protein|||Cancer-associated retinopathy protein|||CAR|||CAR protein|||p26|||Protein CAR|||RCV1|||RCVRN|||RECO_HUMAN|||Recoverin|||S-modulin
Sequence GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Product Details

Product Type Protein
Species Human
Source Sf9 Insect Cells
Tag 10*His, Myc
Endotoxin Level <1.0 Eu/µg
Molecular Weight 27.0 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.