Cat. No.: IBDP-530101
Size:
Online InquiryTarget Information
Sequence | EKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRG WAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYV TKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIE VSNPSLLDPDQDATYFGAFKVRDID |
Sequence Similarities | Belongs to the tumor necrosis factor family. |
Amino Acids | 143 to 317 |
Cellular Localization | Cytoplasm. Secreted and Cell membrane. |
Tissue Specificity | Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid. |
Function | Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. |
Product Details
Product Type | Protein |
Species | Human |
Source | E. coli |
Endotoxin Level | ≤1.0 Eu/µg |
Protein Length | Protein fragment |
Molecular Weight | 20 kDa |
Purity | >95% |
Active | Yes |
Animal free | Yes |
Nature | Recombinant |
Application | FuncS, SDS-PAGE |
Storage & Handling
Shipping | Shipped at room temperature. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |