Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human RANKL Protein

Cat. No.: IBDP-530102

Size:

Target Information

Sequence EKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRG WAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYV TKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIE VSNPSLLDPDQDATYFGAFKVRDID
Sequence Similarities Belongs to the tumor necrosis factor family.
Amino Acids 143 to 317
Cellular Localization Cytoplasm. Secreted and Cell membrane.
Tissue Specificity Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid.
Function Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy.

Product Details

Product Type Protein
Species Human
Source E. coli
Endotoxin Level <1.0 Eu/µg
Protein Length Protein fragment
Molecular Weight 35 kDa
Purity >95%
Active Yes
Animal free No
Nature Recombinant
Application FuncS, SDS-PAGE

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.