Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human PRDX1 Protein

Cat. No.: IBDP-531051

Size:

Target Information

Synonyms Peroxiredoxin-1|||Natural killer cell-enhancing factor A|||NKEF-A|||Proliferation-associated gene protein|||PAG|||Thioredoxin peroxidase 2|||Thioredoxin-dependent peroxide reductase 2|||PAGA|||PAGB|||TDPX2
Sequence MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His, 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 27.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.