Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human Peroxiredoxin-2/PRDX2 Protein

Cat. No.: IBDP-530767

Size:

Target Information

Synonyms Epididymis secretory sperm binding protein Li 2a|||HEL S 2a|||MGC4104|||Natural killer cell enhancing factor B|||Natural killer cell-enhancing factor B|||Natural Killer Enhancing Factor B|||NKEF B|||NKEF-B|||NKEFB|||Peroxiredoxin 2|||Peroxiredoxin-2|||PRDX 2|||PRDX2|||PrP|||PRX2|||PRXII|||PTX1|||TDPX1|||Thiol Specific Antioxidant 1 |||Thiol specific antioxidant protein|||Thiol-specific antioxidant protein|||Thioredoxin Dependent Peroxide Reductase 1|||Thioredoxin peroxidase 1|||Thioredoxin-dependent peroxide reductase 1|||Torin|||TPX1|||TSA
Sequence ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Product Details

Product Type Protein
Species Human
Source E. coli
Tag His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 25.8 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.