Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human OCIL/CLEC2D Protein

Cat. No.: IBDP-531525

Size:

Target Information

Synonyms C-type lectin domain family 2 member D|||Lectin-like NK cell receptor|||Lectin-like transcript 1|||LLT-1|||CLAX|||LLT1|||OCIL|||CLEC2D
Sequence RANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag hFc, Avi
Endotoxin Level <1.0 Eu/µg
Molecular Weight 68-78 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.