Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human NKp46/NCR1 Protein

Cat. No.: IBDP-532778

Size:

Target Information

Synonyms rHuNatural Cytotoxicity Triggering Receptor 1/NCR1, Fc|||Natural cytotoxicity triggering receptor 1|||Lymphocyte antigen 94 homolog|||NK cell-activating receptor|||Natural killer cell p46-related protein|||NK-p46|||NKp46|||hNKp46|||CD335|||NCR1|||LY94
Sequence QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQN

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag hFc
Endotoxin Level <1.0 Eu/µg
Molecular Weight 66.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.