Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human NKG2D/CD314 Protein

Cat. No.: IBDP-530703

Size:

Target Information

Synonyms CD314|||KLRK1|||CD314 antigen|||Killer cell lectin-like receptor subfamily K member 1|||killer cell lectin-like receptor subfamily K|||member 1|||KLR|||NK cell receptor D|||NKG2-D|||NKG2-D type II integral membrane protein|||NKG2-D-activating NK receptor|||NKG2D
Sequence FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 20-30 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.