Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human NKG2D/CD314 Protein

Cat. No.: IBDP-530702

Size:

Target Information

Synonyms CD314|||CD314 antigen |||D12S2489E|||Killer cell lectin like receptor subfamily K member 1|||Killer cell lectin-like receptor subfamily K member 1|||KLR|||KLRC4 KLRK1 readthrough|||KLRK1|||NK cell receptor D|||NK lectin-like receptor|||NKG2 D activating NK receptor|||NKG2 D type II integral membrane protein|||NKG2-D|||NKG2-D type II integral membrane protein|||NKG2-D-activating NK receptor|||Nkg2d|||NKG2D_HUMAN|||NKLLR|||NKR P2|||Nkrp2
Sequence FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag hFc
Endotoxin Level <1.0 Eu/µg
Molecular Weight 43.6 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.