Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human NKG2A Protein

Cat. No.: IBDP-530697

Size:

Target Information

Synonyms NKG2-A/NKG2-B type II integral membrane protein|||CD159 antigen-like family member A|||NK cell receptor A|||NKG2-A/B-activating NK receptor|||CD159a|||KLRC1|||NKG2A
Sequence RHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag 8*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 25-40 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.