Cat. No.: IBDP-530195
Size:
Online InquiryTarget Information
| Sequence | SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFK QYFFETKCRD PNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAA WRFIRIDTACVCVLSRKAVRRA |
| Sequence Similarities | Belongs to the NGF-beta family. |
| Amino Acids | 122 to 241 |
| Cellular Localization | Secreted. |
| Function | Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI (PubMed:20164177). |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Endotoxin Level | ≤1.0 Eu/µg |
| Protein Length | Protein fragment |
| Molecular Weight | 14 kDa |
| Purity | >97% |
| Active | Yes |
| Animal free | Yes |
| Nature | Recombinant |
| Application | FuncS, HPLC, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |