Cat. No.: IBDP-530356
Size:
Online InquiryTarget Information
Sequence | VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIAS FVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH |
Sequence Similarities | Belongs to the peptidase S1 family. Elastase subfamily. Contains 1 peptidase S1 domain. |
Amino Acids | 168 to 267 |
Tissue Specificity | Bone marrow cells. |
Function | Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis. |
Product Details
Product Type | Protein |
Species | Human |
Source | Wheat Germ |
Tag | GST |
Protein Length | Protein fragment |
Animal free | No |
Nature | Recombinant |
Application | ELISA, WB |
Storage & Handling
Shipping | Shipped with Dry Ice. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |