Cat. No.: IBDP-531393
Size:
Online InquiryTarget Information
| Sequence | RRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQG RPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQ |
| Sequence Similarities | Contains 1 death domain. Contains 1 TIR domain. |
| Amino Acids | 31 to 130 |
| Cellular Localization | Cytoplasm. |
| Tissue Specificity | Ubiquitous. |
| Function | Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | Wheat Germ |
| Protein Length | Protein fragment |
| Molecular Weight | 37 kDa |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | ELISA, SDS-PAGE, WB |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |