Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human MKK7 Protein

Cat. No.: IBDP-531679

Size:

Target Information

Sequence MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLAND GGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEI
Sequence Similarities Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily. Contains 1 protein kinase domain.
Amino Acids 1 to 99
Cellular Localization Nucleus. Cytoplasm.
Tissue Specificity Ubiquitous; with highest level of expression in skeletal muscle. Isoform 3 is found at low levels in placenta, fetal liver, and skeletal muscle.
Function Stress activated, dual specificity kinase that activates the JUN kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3.

Product Details

Product Type Protein
Species Human
Source Wheat Germ
Tag GST
Protein Length Protein fragment
Animal free No
Nature Recombinant
Application ELISA, WB

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.