Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human MIP-3 beta/CCL19 Protein

Cat. No.: IBDP-531390

Size:

Target Information

Sequence GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLC APPDQPWVERIIQRLQRTSAKMKRRSS
Sequence Similarities Belongs to the intercrine beta (chemokine CC) family.
Amino Acids 22 to 98
Cellular Localization Secreted.
Tissue Specificity Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.
Function May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Specifically binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Endotoxin Level ≤0.005 Eu/µg
Protein Length Full length protein
Molecular Weight 9 kDa
Purity ≥95%
Active No
Animal free Yes
Nature Recombinant
Application HPLC, MS, SDS-PAGE

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at Room Temperature.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.