Cat. No.: IBDP-531389
Size:
Online InquiryTarget Information
Sequence | GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLC APPDQPWVERIIQRLQRTSAKMKRRSS |
Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
Amino Acids | 22 to 98 |
Cellular Localization | Secreted. |
Tissue Specificity | Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach. |
Function | May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Specifically binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. |
Product Details
Product Type | Protein |
Species | Human |
Source | E. coli |
Endotoxin Level | <1.0 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 9 kDa |
Purity | >95% |
Active | No |
Animal free | No |
Nature | Recombinant |
Application | SDS-PAGE |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |