Recombinant Human MCP2 Protein

Target Information

Sequence	QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKE VCADPKERWVRDSMKHLDQIFQNLKP
Sequence Similarities	Belongs to the intercrine beta (chemokine CC) family.
Amino Acids	24 to 99
Cellular Localization	Secreted.
Tissue Specificity	Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, spleen and prostate.
Function	Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Endotoxin Level	<0.1 Eu/μg
Protein Length	Full length protein
Molecular Weight	9 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.