Recombinant Human MAdCAM1 Protein

Target Information

Sequence	QSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLG AVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQL TVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEV QEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHR QAIPVLHSPTSPEPPDTTSPESPDTTSPESPDTTSQEPPDTTSPEPPDKT SPEPAPQQGSTHTPRSPGSTRTRRPEISQAGPTQGEVIPTGSSKPAGDQ
Sequence Similarities	Contains 2 Ig-like (immunoglobulin-like) domains.
Amino Acids	19 to 317
Cellular Localization	Membrane.
Tissue Specificity	Highly expressed on high endothelial venules (HEV) and lamina propia venules found in the small intestine, and to a lesser extent in the colon and spleen. Very low levels of expression found in pancreas and brain. Not expressed in the thymus, prostate, ovaries, testis, heart, placenta, lung, liver, skeletal muscle, kidney or peripheral blood leukocytes.
Function	Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.

Product Details

Product Type	Protein
Species	Human
Source	Mammalian
Tag	His
Protein Length	Protein fragment
Molecular Weight	40 kDa
Purity	>85%
Active	No
Animal free	No
Nature	Recombinant
Application	MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.