Cat. No.: IBDP-531138
Size:
Online InquiryTarget Information
Sequence | QFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYF ETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI |
Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
Amino Acids | 22 to 113 |
Cellular Localization | Secreted. |
Tissue Specificity | Most abundant in heart, skeletal muscle and adrenal gland. Lower levels in placenta, liver, pancreas and bone marrow. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are found in high levels in synovial fluids from rheumatoid patients. |
Function | Chemotactic factor that attracts T-cells and monocytes, but not neutrophils, eosinophils, or B-cells. Acts mainly via CC chemokine receptor CCR1. Also binds to CCR3. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are more potent chemoattractants than the small-inducible cytokine A15. |
Product Details
Product Type | Protein |
Species | Human |
Source | E. coli |
Endotoxin Level | <1.0 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 10 kDa |
Purity | >97% |
Active | Yes |
Animal free | No |
Nature | Recombinant |
Application | FuncS, HPLC, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |