Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human Macrophage inflammatory Protein 5

Cat. No.: IBDP-531137

Size:

Target Information

Sequence MQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSY FETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Sequence Similarities Belongs to the intercrine beta (chemokine CC) family.
Amino Acids 22 to 113
Cellular Localization Secreted.
Tissue Specificity Most abundant in heart, skeletal muscle and adrenal gland. Lower levels in placenta, liver, pancreas and bone marrow. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are found in high levels in synovial fluids from rheumatoid patients.
Function Chemotactic factor that attracts T-cells and monocytes, but not neutrophils, eosinophils, or B-cells. Acts mainly via CC chemokine receptor CCR1. Also binds to CCR3. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are more potent chemoattractants than the small-inducible cytokine A15.

Product Details

Product Type Protein
Species Human
Source E. coli
Endotoxin Level <1.0 Eu/µg
Protein Length Full length protein
Molecular Weight 10 kDa
Purity >95%
Active No
Animal free No
Nature Recombinant
Application MS, SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.