Cat. No.: IBDP-530416
Size:
Online InquiryTarget Information
Sequence | ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQV CADPSEEWVQKYVSDLELSA |
Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
Amino Acids | 23 to 92 |
Cellular Localization | Secreted. |
Function | Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). |
Product Details
Product Type | Protein |
Species | Human |
Source | E. coli |
Endotoxin Level | <1.0 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 8 kDa |
Purity | >96% |
Active | Yes |
Animal free | No |
Nature | Recombinant |
Application | FuncS, HPLC, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |