Cat. No.: IBDP-530391
Size:
Online InquiryTarget Information
| Sequence | EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYL KKAFLLVQYIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK ACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQD VVTKPDCN |
| Amino Acids | 33 to 190 |
| Cellular Localization | Cell membrane and Secreted > extracellular space. |
| Function | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Endotoxin Level | <0.005 Eu/µg |
| Protein Length | Protein fragment |
| Molecular Weight | 19 kDa |
| Purity | ≥95% |
| Active | Yes |
| Animal free | Yes |
| Nature | Recombinant |
| Application | Cell Culture, FuncS, HPLC, MS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at Room Temperature. |
| Handling | Avoid freeze / thaw cycle. |