Cat. No.: IBDP-530859
Size:
Online InquiryTarget Information
| Synonyms | Lymphotactin|||ATAC|||C motif chemokine 1|||Cytokine SCM-1|||Lymphotaxin|||SCM-1-alpha|||Small-inducible cytokine C1|||XC chemokine ligand 1|||LTN|||SCYC1 and XCL1 |
| Sequence | VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
| Function | XCL1, a C class chemokine also known as Lymphotactin, is mainly produced by activated CD8+ T cells and natural killer cells. XCL1 signals by binding to the XCR1 receptor. XCL1 is involved in infectious, inflammatory and immunological diseases. Lymphotactin/XCL1 Protein (HEK293, Fc-His) is produced in HEK293 cells with six C-Terminal His-tags and a C-Terminal Fc-tag. It consists of 93 amino acids (V22-G114). |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | hFc, 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 54.0 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |