Recombinant Human Lymphotactin/ATAC Protein

Target Information

Sequence	GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADP QATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Sequence Similarities	Belongs to the intercrine gamma family.
Amino Acids	23 to 114
Cellular Localization	Secreted.
Tissue Specificity	Highest level in spleen, lower in peripheral leukocytes and very low levels in lung, colon and small intestine.
Function	Chemotactic activity for lymphocytes but not for monocytes or neutrophils.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Endotoxin Level	<1.0 Eu/µg
Protein Length	Full length protein
Molecular Weight	10 kDa
Purity	>97%
Active	Yes
Animal free	No
Nature	Recombinant
Application	FuncS, HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.