Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human Lymphocyte antigen 6E/LY6E Protein

Cat. No.: IBDP-531125

Size:

Target Information

Synonyms LY6E|||9804|||RIGE|||SCA2|||TSA1|||Lymphocyte antigen 6E|||Ly-6E|||Retinoic acid-induced gene E protein|||RIG-E|||Stem cell antigen 2|||SCA-2|||Thymic shared antigen 1|||TSA-1
Sequence LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Product Details

Product Type Protein
Species Human
Source E. coli
Tag His, SUMO
Endotoxin Level <1.0 Eu/µg
Molecular Weight 24.5 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.