Cat. No.: IBDP-530583
Size:
Online InquiryTarget Information
| Synonyms | rHuCCL3L1, His|||C-C Motif Chemokine 3-Like 1|||Small-Inducible Cytokine A3-Like 1|||Tonsillar Lymphocyte LD78 Beta Protein|||CCL3L1|||D17S1718|||G0S19-2|||SCYA3L1|||CCL3L3 |
| Sequence | APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAHHHHHH |
| Function | LD78-beta/CCL3L1 Protein (HEK293 His) is a multiallelic copy number variable, which plays a crucial role in immunoregulatory and hosts defense through the production of macrophage inflammatory protein (MIP)-1α. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 16 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |