Cat. No.: IBDP-530581
Size:
Online InquiryTarget Information
| Sequence | APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQV CADPSEEWVQ KYVSDLEPSAVDHHHHHH |
| Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
| Amino Acids | 24 to 93 |
| Cellular Localization | Secreted. |
| Function | Chemotactic for lymphocytes and monocytes. Is a ligand for CCR1, CCR3 and CCR5. Is an inhibitor of HIV-1-infection. The processed form LD78-beta(3-70) shows a 20-fold to 30-fold higher chemotactic activity and is a very potent inhibitor of HIV-1-infection. LD78-beta(3-70) is also a ligand for CCR1, CCR3 and CCR5. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | His |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 9 kDa |
| Purity | >95% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | HPLC, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |