Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human KLF6 Protein

Cat. No.: IBDP-531387

Size:

Target Information

Synonyms Krueppel-Like Factor 6|||B-Cell-Derived Protein 1|||Core Promoter Element-Binding Protein|||GC-Rich Sites-Binding Factor GBF|||Proto-Oncogene BCD1|||Suppressor of Tumorigenicity 12 Protein|||Transcription Factor Zf9|||KLF6|||BCD1|||COPEB|||CPBP|||ST12
Sequence MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVS

Product Details

Product Type Protein
Species Human
Source E. coli
Tag Tag Free
Endotoxin Level <1.0 Eu/µg
Molecular Weight 16.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.