Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human KIR2DS3 Protein

Cat. No.: IBDP-531098

Size:

Target Information

Synonyms KIR2DS3|||NKAT7Killer cell immunoglobulin-like receptor 2DS3|||MHC class I NK cell receptor|||Natural killer-associated transcript 7|||NKAT-7
Sequence HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Product Details

Product Type Protein
Species Human
Source P. pastoris
Tag His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 26.7 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.