Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human KIR2DL3 Protein

Cat. No.: IBDP-530848

Size:

Target Information

Synonyms rHuKiller cell immunoglobulin-like receptor 2DL3/KIR2DL3, His|||Killer Cell Immunoglobulin-Like Receptor 2DL3|||CD158 Antigen-Like Family Member B2|||KIR-023GB|||Killer Inhibitory Receptor cl 2-3|||MHC Class I NK Cell Receptor|||NKAT2a|||NKAT2b|||Natural Killer-Associated Transcript 2|||NKAT-2|||p58 Natural Killer Cell Receptor Clone C
Sequence HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 35-50 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.