Recombinant Human IL37 Protein

Target Information

Sequence	MVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFAL ASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLA AQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFE NRKHIEFSFQ PVCKAEMSPS EVSD
Sequence Similarities	Belongs to the IL-1 family.
Amino Acids	46 to 218
Cellular Localization	Cytoplasm > cytosol. Nucleus. Secreted. Stimulation with IL1B leads to colocalization with SMAD3 mostly in perinuclear regions. Only the CASP1-cleaved mature form translocates into the nucleus upon LPS stimulation.
Tissue Specificity	In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis, colon, placenta, lung and lymph node. Isoform D and isoform E were found only in testis and bone marrow. Whereas only isoform A is found in brain, only isoform B in kidney and only isoform C in heart.
Function	Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Protein Length	Full length protein
Molecular Weight	19 kDa
Purity	>95%
Active	Yes
Animal free	Yes
Nature	Recombinant
Application	FuncS, HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.