Cat. No.: IBDP-531236
Size:
Online InquiryTarget Information
Sequence | NEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQ EVETLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDNCFR VMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPPWSP SSPPHSTGSVRPVRAQGEGLLPHHHHHHHH |
Sequence Similarities | Belongs to the IL-34 family. |
Amino Acids | 21 to 242 |
Cellular Localization | Secreted. |
Tissue Specificity | Detected in the sinusoidal epithelium in the red pulp of spleen (at protein level). Predominantly expressed in spleen. Also detected in a range of other tissues including heart, brain, lung, liver, kidney, thymus, testis, ovary, small intestine, prostate and colon. |
Function | Cytokine that promotes the differentiation and viability of monocytes and macrophages. Stimulates phosphorylation of MAPK1/ERK2 AND MAPK3/ERK1. Ligand for colony-stimulating factor-1 receptor CSF1R. |
Product Details
Product Type | Protein |
Species | Human |
Source | HEK 293 Cells |
Tag | His |
Endotoxin Level | <1.0 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 53 kDa |
Purity | >95% |
Active | Yes |
Animal free | No |
Nature | Recombinant |
Application | FuncS, HPLC, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |