Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human IL-3 Protein

Cat. No.: IBDP-530373

Size:

Target Information

Sequence APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILME NNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIK DGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Sequence Similarities Belongs to the IL-3 family.
Amino Acids 20 to 152
Cellular Localization Secreted.
Tissue Specificity Activated T-cells, mast cells, natural killer cells.
Function Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Endotoxin Level <0.005 Eu/µg
Protein Length Full length protein
Molecular Weight 15 kDa
Purity ≥95%
Active Yes
Animal free Yes
Nature Recombinant
Application Cell Culture, FuncS, HPLC, MS, SDS-PAGE

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at Room Temperature.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.