Cat. No.: IBDP-530375
Size:
Online InquiryTarget Information
| Synonyms | rHuIL-3|||Hematopoietic growth factor|||Mast cell growth factor|||MCGF|||Multipotential colony-stimulating factor|||P-cell-stimulating factor |
| Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Function | IL-3 Protein is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 15.2 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |