Cat. No.: IBDP-531435
Size:
Online InquiryTarget Information
| Synonyms | rHuIL-22|||Cytokine Zcyto 18|||IL-TIF |
| Sequence | APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
| Function | IL-22 Protein (HEK293) is a HEK293 cell derived cytokine protein and intricate member of the immune response. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 16-30 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |