Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human IL-20 Protein

Cat. No.: IBDP-531481

Size:

Target Information

Synonyms rHuIL-20|||IL20|||Cytokine Zcyto10
Sequence MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Function IL-20 Protein is a member of the IL-10 family of cytokines. Interleukin-20 binds to the IL-20 heterodimeric receptor with a Kd of 1.5 nM.

Product Details

Product Type Protein
Species Human
Source E. coli
Tag Tag Free
Endotoxin Level <1.0 Eu/µg
Molecular Weight 17.6 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.