Cat. No.: IBDP-531481
Size:
Online InquiryTarget Information
| Synonyms | rHuIL-20|||IL20|||Cytokine Zcyto10 |
| Sequence | MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE |
| Function | IL-20 Protein is a member of the IL-10 family of cytokines. Interleukin-20 binds to the IL-20 heterodimeric receptor with a Kd of 1.5 nM. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 17.6 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |