Cat. No.: IBDP-531491
Size:
Online InquiryTarget Information
| Synonyms | CX2|||Cytokine CX2|||IL17C|||IL-17CMGC126884|||interleukin 17C|||interleukin-17C |
| Sequence | HHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV |
| Function | IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides. IL-17C stimulates the release of cytokines and is implicated in autoimmune disorders and bacterial infections. IL-17C Protein, Human (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant human IL-17C protein with His tag and Avi tag at the C-terminus and is expressed in HEK293 cells. It consists of 179 amino acids (H19-V197). |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | Avi, 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 24-26 kDa |
| Purity | ≥90% |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |