Cat. No.: IBDP-531524
Size:
Online InquiryTarget Information
| Synonyms | Interleukin-17B|||IL-17B|||Cytokine Zcyto7|||IL-20|||NIRF|||ZCYTO7 |
| Sequence | QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF |
| Function | IL-17B is a proinflammatory cytokine and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β. IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis. IL-17B Protein (HEK293, Fc) is a recombinant human IL-17B protein with hFc tag at the C-terminus and is expressed in HEK293 cells. It consists of 160 amino acids (Q21-F180). |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | hFc |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 48 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |