Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human IL-12 beta Protein

Cat. No.: IBDP-530737

Size:

Target Information

Synonyms Interleukin-12 subunit beta|||IL-12B|||Cytotoxic lymphocyte maturation factor 40 kDa subunit|||CLMF p40|||IL-12 subunit p40|||NK cell stimulatory factor chain 2|||NKSF2|||IL12B|||NKSF2
Sequence IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Function IL-12 beta Protein, also known as natural killer cell stimulatory factor 2, is a common subunit (p40) of IL-12 and IL-23. IL-12 is a inflammatory factor expressed by activated macrophages, and involves in Th1-type immune response against cancer. IL-12 beta Protein located outside the cell membrane, involves in singalling mediated by Jak-STAT. IL-12 beta Protein consists of 328 amino acids (M1-S328) with a fibronectin type-III domain (237-328 a.a). IL-12 beta Protein (I23-S328) is produced in HEK293 cells with tag free.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag Tag Free
Endotoxin Level <1.0 Eu/µg
Molecular Weight 40-47 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.