Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human IL-10 Protein

Cat. No.: IBDP-530669

Size:

Target Information

Sequence SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKE SLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKT LRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYI EAYMTMKIRN
Sequence Similarities Belongs to the IL-10 family.
Amino Acids 19 to 178
Cellular Localization Secreted.
Tissue Specificity Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types.
Function Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Endotoxin Level ≤0.005 Eu/µg
Protein Length Full length protein
Purity ≥95%
Active Yes
Animal free Yes
Nature Recombinant
Application Biological Activity, FuncS, HPLC, MS, SDS-PAGE

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at Room Temperature.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.