Cat. No.: IBDP-530669
Size:
Online InquiryTarget Information
Sequence | SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKE SLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKT LRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYI EAYMTMKIRN |
Sequence Similarities | Belongs to the IL-10 family. |
Amino Acids | 19 to 178 |
Cellular Localization | Secreted. |
Tissue Specificity | Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types. |
Function | Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. |
Product Details
Product Type | Protein |
Species | Human |
Source | HEK 293 Cells |
Endotoxin Level | ≤0.005 Eu/µg |
Protein Length | Full length protein |
Purity | ≥95% |
Active | Yes |
Animal free | Yes |
Nature | Recombinant |
Application | Biological Activity, FuncS, HPLC, MS, SDS-PAGE |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at Room Temperature. |
Handling | Avoid freeze / thaw cycle. |