Recombinant Human IGF2BP2/IMP-2 Protein

Target Information

Sequence	MASMTGGQQMGRGSEFMMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQV LLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKI QIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAK IAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPG GTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITLEHHHHHH
Sequence Similarities	Belongs to the RRM IMP/VICKZ family. Contains 4 KH domains. Contains 2 RRM (RNA recognition motif) domains.
Amino Acids	1 to 220
Cellular Localization	Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Localizes at the connecting piece and the tail of the spermatozoa.
Tissue Specificity	Expressed in oocytes, granulosa cells of small and growing follicles, Leydig cells, spermatogonia and semen (at protein level). Expressed in testicular cancer (at protein level). Expressed weakly in heart, placenta, skeletal muscle, bone marrow, colon, kidney, salivary glands, testis and pancreas. Detected in fetal liver, fetal ovary, gonocytes and interstitial cells of the testis.
Function	Binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binding is isoform-specific. May regulate translation of target mRNAs.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Tag	His, T7 Tag
Endotoxin Level	<1.0 Eu/µg
Protein Length	Protein fragment
Molecular Weight	27 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.