Cat. No.: IBDP-531280
Size:
Online InquiryTarget Information
| Synonyms | rHuIFN-λ1/IL-29|||IL-29|||IFN-lambda-1|||Cytokine Zcyto21|||Interleukin-29 |
| Sequence | GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST |
| Function | IFN-lambda 1 (IL-29) is a member of the Type-III interferon family. IFN-lambda 1 signals through a heterodimeric receptor complex comprising IFNλ receptor 1 (IFNLR1) and IL-10 receptor subunit-β (IL-10RB). When IFN-lambda 1 binds with the receptor complex, Jak1 and Tyk2 will be activated, and leads to subsequent tyrosine phosphorylation of the IFN-λR1, and activation of STAT1 and STAT2. IFN-lambda 1 modulates immunity in infections and autoimmune diseases. IFN-lambda 1/IL-29 Protein is a recombinant human IFN-lambda 1 (G20-T200) without any tag, which is produced in E. coli. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 19.8 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |