Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human IBSP Protein

Cat. No.: IBDP-530660

Size:

Target Information

Synonyms BNSP|||Bone sialoprotein 2|||Bone sialoprotein II|||BSP|||BSP II|||BSPII|||Cell binding sialoprotein|||Cell-binding sialoprotein|||IBSP|||Integrin binding sialoprotein|||Integrin-binding sialoprotein|||SIAL_HUMAN|||SPII
Sequence AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESE

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His, SUMO
Endotoxin Level <1.0 Eu/µg
Molecular Weight 32.4 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.