Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human HLA-G Protein

Cat. No.: IBDP-530594

Size:

Target Information

Synonyms B2 microglobulin|||DADB-15K14.8|||HLA 6.0|||HLA class I histocompatibility antigen alpha chain G|||Major histocompatibility complex class I G|||MHC class I antigen|||MHC class I antigen G|||MHC G|||T-cell A locus|||TCA
Sequence GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 39.6 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.