Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human HLA-G Protein

Cat. No.: IBDP-530595

Size:

Target Information

Synonyms B2 microglobulin|||DADB-15K14.8|||HLA 6.0|||HLA class I histocompatibility antigen alpha chain G|||HLA class I histocompatibility antigen|||alpha chain G|||HLA class I molecule|||HLA G|||HLA G antigen|||HLA G histocompatibility antigen class I G|||HLA G3|||HLA-G|||HLA-G histocompatibility antigen|||class I|||HLA60|||HLAG|||HLAG_HUMAN|||Major histocompatibility complex class I G|||MHC class I antigen|||MHC class I antigen G|||MHC G|||T-cell A locus|||TCA
Sequence GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His, SUMO
Endotoxin Level <1.0 Eu/µg
Molecular Weight 51.6 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.