Recombinant Human Hepcidin Protein

Target Information

Sequence	SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCH RSKCGMCCKT
Sequence Similarities	Belongs to the hepcidin family.
Amino Acids	25 to 84
Cellular Localization	Secreted.
Tissue Specificity	Highest expression in liver and to a lesser extent in heart and brain. Low levels in lung, tonsils, salivary gland, trachea, prostate gland, adrenal gland and thyroid gland. Secreted into the urine.
Function	Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages.Has strong antimicrobial activity against E.coli ML35P N.cinerea and weaker against S.epidermidis, S.aureus and group b streptococcus bacteria. Active against the fungus C.albicans. No activity against P.aeruginosa.

Product Details

Product Type	Protein
Species	Human
Source	Wheat Germ
Protein Length	Full length protein
Molecular Weight	32 kDa
Active	No
Animal free	No
Nature	Recombinant
Application	ELISA, SDS-PAGE, WB

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.