Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human HCC-1/CCL14 Protein

Cat. No.: IBDP-531136

Size:

Target Information

Sequence TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKENHHHHHH
Function HCC-1/CCL14 Protein (HEK293, His) is a CC chemokine with weak activity against human monocytes, promotes monocyte, eosinophil and T-lymphocyte chemotaxis, and mediates allergic airway inflammation and cancer. HCC-1/CCL14 Protein (HEK293, His) is a recombinant human HCC-1/CCL14(T20-N93) expressed by HEK293 with a his tag.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 13 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.